Ihre Suche nach „Susanne Binder“ in „Physik & Astronomie“
Hipparchs Himmelsglobus
Susanne M. Hoffmann
Statt 79.99 € 22
62.99 €
220.00 €
Statt 99.99 € 22
62.99 €
Wie der Löwe an den Himmel kam
Susanne M. Hoffmann
Statt 30.00 € 22
24.99 €
101.65 €
The Science and Technology of Cement and other Hydraulic Binders
Vipin Kant Singh
250.00 €
19.60 €
11.20 €
Eine Neukonzeption des naturwissenschaftlich-physikalischen Anfangsunterrichts zur Verbindung von Sach- und Fachunterricht
Felix Eibenstein
29.99 €
15.44 €
Massenspektrensammlung von Lösungsmitteln, Verunreinigungen, Säulenbelegmaterialien und einfachen aliphatischen Verbindungen
Margot Spiteller, Gerhard Spiteller
59.99 €
16.10 €
Monte Carlo Simulation in Statistical Physics / Springer Series in Solid-State Sciences Bd.80
Kurt Binder, Dieter W. Heermann
85.59 €
Monte Carlo Simulation in Statistical Physics / Springer Series in Solid-State Sciences Bd.80
Kurt Binder, Dieter W. Heermann
85.59 €
Monte Carlo Simulation in Statistical Physics / Graduate Texts in Physics
Kurt Binder, Dieter W. Heermann
69.54 €
Sequence-Specific DNA Binders for the Therapy of Mitochondrial Diseases / Springer Theses
Takuya Hidaka
Statt 160.49 € 22
149.79 €
14.70 €
Statt 74.99 € 22
59.99 €
11.79 €
Tools of Radio Astronomy / Astronomy and Astrophysics Library
Thomas L. Wilson, Kristen Rohlfs, Susanne Hüttemeister
Statt 128.39 € 22
90.94 €
Background Processes in the Electrostatic Spectrometers of the KATRIN Experiment / Springer Theses
Susanne Mertens
Statt 106.99 € 22
96.29 €
Tools of Radio Astronomy / Astronomy and Astrophysics Library
T. L. Wilson, Susanne Hüttemeister
53.49 €
Tools of Radio Astronomy / Astronomy and Astrophysics Library
T. L. Wilson, Kristen Rohlfs, Susanne Hüttemeister
84.99 €
An Introduction to Inertial Confinement Fusion
Susanne Pfalzner
82.99 €
211.86 €
188.32 €
Moderne Probleme der Metallphysik
Alfred Seeger
59.99 €
235.00 €
211.86 €